Language
View
Grid Images
Prompt Autocomplete
Content Filtering
Help & Support
daily claim icon: glass is empty
Daily Claim
Today
S
+3
S
+3
M
+4
T
+4
W
+5
T
+5
F
+6
Claim daily to grow your streak.
daily claim icon: a bucket filled with gold
Credit packs
Referrals
Referrals
quests icon
Quests
yellow jacket

yellow jacket

0 Followers
breasts1girlblushlong hairlooking at viewersololarge breastsjacketsweatsmilenavelnipplesindoorsthighsopen mouthlong sleevesshort hairmedium breastscollarbone1boyshirtheterouncensoredpussystandingoutdoorsbare shouldersblonde hairopen clothesblue eyes
AI art "Weekend Getaway with Michelle"
30

Weekend Getaway with Michelle

dreamerofdreams
18
AI art 'Parallel Lines' with user description '====== There's a force Stronger than us But this love I can't ignore We run the same course But we never touch My body attracts yours What if I am your missing piece What if we mess with destiny What if the definition of we Is two people in time living their own lives Like two parallel lines That'll never, that'll never collide Steady, I just keep on hoping That one of us will find Find a way we can intertwine Steady, I just keep, I keep on hoping -DVBBS X CMC$- ====== It has been 4 months now but something just didn’t feel right. Especially now. I placed my phone on the table—screen down. My coffee was still warm. I took a sip and I looked at him. “What are we doing? Is this how you imagined we would be?” He sighed and put down his phone too. “Am I not giving you all the satisfaction you wanted?” He was. For the first time in a long time, someone finally gave me the excitement my body asked for; But something was missing inside me. My phone buzzed. Another notification. Finally, an excuse to ignore his question. Warmth flooded my face as I blushed “She actually came…” I whispered to myself. I bit my lips “I…I’m need to use the restroom” I could not control myself. Alone with the glow of my phone on my face, I ran my fingers between my thighs. Wet. How? I searched more—drenched. My lust fogged up my mind as I stared at the web between my fingers. I needed to tell him. “I’m sorry. Thank you for giving me it all..but I don’t think it is going to work out” He stood up slowly—looked at me “Victoria, I really like you and maybe even love you. But I hope you find what you are looking for” He gave me a kiss on my forehead and left. I sat there. Alone. Confused. Tears flowed but my heart was racing from what happened in the restroom. As I stood up to leave, something slid off. It was a picture of me and Harriet from high school. Oh how she helped me brought the courage out of me in life. I really missed her. My reminiscence was interrupted by another notification. No likes yet from my recent post. No. Perhaps I need to learn more from @peterco, @cef_ultra and @reptorn. But it’s her again. “I’m so stupid! What am I doing here?” I responded and shoved my phone away. More buzzing — more frequent. My head started to spin. I ran. “Please wait for me…” Nothing else mattered. As I approached my front door I felt my knees weak. My hands were shaking and I dropped my keys “Fuck!” I took a deep breath—slowly, I opened the door. I could hear her. She was there. Moaning. Then it happened—again. “Ahh…anhh!!!” Her voice echoed through my apartment. My phone buzzed again. I peeked into the room. My Harriet was still there. Gently, I took the gag off her. With her soft trembling voice, she whispered. “V..Vicky? Is that y..you?” “Yes, it’s me. I’m here now” I proceed to remove her blindfold. “Why did you leave me? I came so many times for you. Didn’t you know?” “Of course I knew dear…I just…I’m sorry…I” I stopped thinking. Harriet was all I needed. I pushed my lips against her and gave her the love she deserved. The love I deserved. We closed our eyes and just let our bodies spoke. I slid my fingers down her hips — between her thighs— just like what I did to mine. I took it out — gently —the one I have been controlling from my phone, the one that has been telling me how many times she came. Harriet gasped. “Haaah…It felt so good Vicky. Can you give…” “Hattie, it’s so wet…” I tasted it. Sweetness. “Shhh, just relax ok?” I slid my fingers in — it was too easy. Pools of ecstasy were on the sheets. But I hesitated. “What’s the matter, Vicky?” Harriet sensed something was wrong “Hattie... Do you really need to leave tomorrow? I… I mean…we just reconnected after so many years and…” “Untie me Vicky” Harriet stern eyes stared tight at me. “Huh?” I stammered. Did I said something wrong? “Untie me. Let me give you something so you will never forget” My shoulders shivered. Red rope marks stayed on Harriet’s soft skin as I pulled the ropes away. With her freed wrists, Harriet grabbed the ropes and pushed both my hands above my head as she sat on me. “Wha…what are you doing?” Harriet did not answer. And I felt the pain between my wrists as they pushed together—tighter. But it was the pain of regret. Perhaps the pain of forgiveness. “Are you ready?” Harriet stared and smiled “Wait for me. I have one more important thing” She whispered. Her soft voice made my body flustered *Click* She handcuffed her own hands. Harriet chuckled and smiled. “Actually… I don’t know where the keys are. Heh..?” She shrugged. My eyes wide opened but before I could realize what happened, Harriet already disappeared below me. Please! I don’t ever want this to ever stop. I couldn’t hold myself. “Hattie, I missed you so much. I didn’t think you’d replied my message, after what happened 3 years ago” Harriet stopped and raised her head. “You’re silly. I’ve been thinking about you”'
29

Parallel Lines

prspxtvs
22
AI art "Swimsuit Gravure (10)"
10

Swimsuit Gravure (10)

freemanlac
2
AI art "Iono masturbating amd having livestream fun"
10

Iono masturbating amd having livestream fun

varcolac
2
AI art '2k followers - Unreleased images' with user description 'Thank you all for hitting 2,000 followers! in celebration, i'm releasing some of my shots since i started. #1 is the first prompt I ever did. #2 is the first render of the Vale Sisters #3 - #9 are unreleased original characters #10 - #19 are character prompts unused #20 - #26 Unreleased sex poses #29 most recent prompt'
27

2k followers - Unreleased images

octavian
4
AI art 'Here Comes the... (1) 😏🔥' with user description 'Couldn't stop thinking about it... so I had to make it go boom a few more times. 😏💥🔥 @peterco @smut317 @gildenstein @casca_kirei-onna @heihund @bad77 @parda @terror2 @varcolac @goobygubby @saltymajor778 @zesoul @azariel @ririfake @poly7 @narillia @murcie @doggomage @ranmafan @valtek'
8

Here Comes the... (1) 😏🔥

reptorn
16
AI art 'Trying'
2

Trying

ranmafan
5
AI art "Cindy Aurum: Oil Change"
15

Cindy Aurum: Oil Change

thoughtzi
AI art 'Initiating LEET protocol! Starting mode 1337 😏💻🔥' with user description 'Golden, dangerous, suspiciously innocent looking and absolutely capable of turning a small milestone into a full system overload. The apples are decorative. The bad decisions are traditional. 😏🍎 @peterco @smut317 @gildenstein @casca_kirei-onna @heihund @bad77 @parda @terror2 @varcolac @goobygubby @saltymajor778 @zesoul @azariel @ririfake @poly7 @narillia @murcie @doggomage @ranmafan'
24

Initiating LEET protocol! Starting mode 1337 😏💻🔥

reptorn
11
AI art "Iono's Second Break"
5

Iono's Second Break

zerogroupe21
3
AI art "Lyra - Brainstorm set 3"
21

Lyra - Brainstorm set 3

barry915
6
AI art "Brock's Amazing Adventure-1"
28

Brock's Amazing Adventure-1

chris789456
AI art '1,000 Follower Special (Ft. Your OC's)' with user description 'Hi everybody! After a couple of days of uncertainty, I finally reached the big 1K milestone! 🎉 I couldn't have done it without all you people who have supported me throughout this wonderful journey of AI discovery! I made this post in particular to thank the 7 creators who were kind enough to bring my quest for followers to an even bigger audience! Your posts are what finally pushed me past that final threshold! The girls in this story are all (based on) these 7 creators' OC's. These are the girls in order of appearance: #1 & 5: Isla (by @cro_bo) #6: Violet Blade (by @zerogroupe21) #7: Annie (by @bad77, also technically not really an OC) #8: Serra (by @azariel) #9: Linia (by @reptorn) #10: Lenna (by @kidd163) #11: Summer (by @parda) So once more, thank you everybody! 🫶❤️ Onwards to the next milestone! @casca_kirei-onna @waltersusu @saltymajor778 @smut317 @gildenstein @goobygubby @peterco @a_casual_prompter @doggomage @thoughtzi @octavian @heihund @warmicestudios'
15

1,000 Follower Special (Ft. Your OC's)

terror2
27
AI art 'Marina at the beach'
11

Marina at the beach

rawbrush09
AI art "The Elevator-1"
30

The Elevator-1

idiidiidi
4
AI art "Where is Iono? - Paldean Treasure Hunt"
19

Where is Iono? - Paldean Treasure Hunt

pokemon_maniac
AI art '(New OCs) Isla has friends 💖' with user description 'I've been working on these for a while, Isla was getting lonely by herself. Meet Amelia and Erin! Amelia, 28 Amelia is a natural caretaker who notices what people need before they do, keeps her kitchen warm, and selects her wardrobe by a personal rubric of feminine, soft, and appropriate that is entirely sincere and consistently, mysteriously off the mark. She is the last person in any room to understand why anyone is looking at her. The floral vine tattoo winding up her right arm is the one detail that contradicts the composed, gentle exterior — she doesn't explain it, doesn't hide it, and changes the subject if pressed — paired always with her gold headband, the one accessory she considers properly elegant and actually is. Erin, 19 Erin is nineteen and already entirely herself, operating on pure instinct with her brain and body in constant disagreement about the order of operations — action always wins, consequence arrives later as a surprise. She's warm, high-energy, and constitutionally incapable of not throwing herself at things, which produces equal parts genuine joy and spectacular situational comedy. Her signature star motif runs through everything — earrings, necklaces, whatever crop top she grabbed that morning — less a deliberate aesthetic than something she keeps picking without thinking, which is very on brand. (I've been away this weekend and ive come back to 40 or so mentions, sorry guys im just not going to be able to keep up with that. Mention me again in the important bits) @goobygubby @terror2 @cef_ultra @octavian @warmicestudios @parda @bad77 @barry915 @zuzul @zesoul @zerogroupe21 @smut317 @gildenstein @reptorn @hollenwulf @heihund @casca_kirei-onna @reptorn @a_casual_prompter @artfx85'
6

(New OCs) Isla has friends 💖

cro_bo
16
AI art 'Which one is your favorite?'
12

Which one is your favorite?

dreamwalker
3
AI art "Iono"
4

Iono

zerogroupe21
5
AI art 'Chapter#01, The Chosen.' with user description 'You hear a jingle; tiiil tiiil tiiil, a bell tied to a red thread. It is said that the red thread of fate is tied to the people who will change your life, in some way, whether good or bad. All the girls were chosen and are gathered in an astral plane where the goddess of dreams, 'Mirla,' dwells. Mirla: I have gathered everyone here today to commence the 'GAMES OF MORPHEUS,' where everyone will face different challenges, either individually or in teams. The tests will consist of physical endurance challenges, intelligence, psychological tests, etc. The way to win will be by the vote of our spectators. If a girl is eliminated, but someone sponsors her, she will be given another chance, but she will face a very difficult test. We are looking for the best of all, number #01. I hope this list is ready because it starts now...'
9

Chapter#01, The Chosen.

dreamwalker
4